PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 537aa    MW: 59321.9 Da    PI: 4.9386
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041406.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS436.91.5e-1331675362374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +e+L +cA+a++++d++ +++l++ l++++s +g+p+qRl ay++e+L arla+s+s+++++l+++e +   s+e l+++++++e++P++kf+++ aN
  Pbr041406.1 167 TEVLCACAKALANNDMSTTEWLISDLRQMVSVSGEPIQRLGAYILEGLIARLASSGSSICASLRCKEPA---SAELLSYMHMLYEICPYFKFGYMSAN 261
                  689*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea++ e+rvHiiDf++ qG+QW++L+qaLa+Rp+gpp++RiTg+++++s   +   l  +g+rL+++Ae+++vpfef++ +    ++++le+L+
  Pbr041406.1 262 GAIAEAMKDESRVHIIDFQVAQGTQWITLIQALAARPGGPPQIRITGIDDSASAyvRGGGLGVVGQRLSRLAESCKVPFEFHA-TGIFGSEVQLEDLE 358
                  **************************************************888899999************************.88899********* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++pgEa+aVn++++lh+++desvs++++rd++++l kslsPkvv++veqe+++n+++Fl rf+++l+y+ a+fds+++ lpre++eri+vE+++l+re
  Pbr041406.1 359 IRPGEAIAVNFAFMLHHMPDESVSSHNHRDRLMRLAKSLSPKVVTLVEQESNTNTAPFLPRFIDTLSYFRAVFDSIDVALPREHRERINVEQHCLARE 456
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn++acegaer+er e l+kWr+r+ +aGF+p pls+++++++k+ll+ ++++ y++ee +g+l+lgW+++pLv+ +aWr
  Pbr041406.1 457 IVNIIACEGAERVERYELLSKWRSRFIMAGFSPCPLSSFVNATIKTLLQGYSEK-YTLEEIDGALYLGWMNQPLVASCAWR 536
                  ****************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.115140517IPR005202Transcription factor GRAS
PfamPF035145.2E-131167536IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MQESYKHVIP NVSHPFGEQP VEEPESYCWP SFQNADHQAS DEVIQGTKLS VQRFEQHSTL  60
ESSSGTSAYP GRSSASSLNF SGNGSPASHP DLHSYQSGGS PVNQSCMLTD TDDLGHKIRE  120
LQNALLGNDS DAFDVYDIID EAGANQIYSE AEHREQMMLM ISRGDLTEVL CACAKALANN  180
DMSTTEWLIS DLRQMVSVSG EPIQRLGAYI LEGLIARLAS SGSSICASLR CKEPASAELL  240
SYMHMLYEIC PYFKFGYMSA NGAIAEAMKD ESRVHIIDFQ VAQGTQWITL IQALAARPGG  300
PPQIRITGID DSASAYVRGG GLGVVGQRLS RLAESCKVPF EFHATGIFGS EVQLEDLEIR  360
PGEAIAVNFA FMLHHMPDES VSSHNHRDRL MRLAKSLSPK VVTLVEQESN TNTAPFLPRF  420
IDTLSYFRAV FDSIDVALPR EHRERINVEQ HCLAREIVNI IACEGAERVE RYELLSKWRS  480
RFIMAGFSPC PLSSFVNATI KTLLQGYSEK YTLEEIDGAL YLGWMNQPLV ASCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-651665364375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346773.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_009346772.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLM5X1200.0M5X120_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5